>3vsq_A mol:protein length:208  G protein-activated inward rectifier potassium channel 2
GSHMRKIQRYVRKDGKCNVHHGNVREKRAETLVFSTHAVISMRDGKLCLMFRVGDLRNS
HIVRASIRAKLIKSKQTSEGEFIPLNQTDINVGYYTGDDRLFLVSPLIISHEINQQSPF
WEISKAQLPKEELEIVVILEGMVEATGMTCQARSSYITSEILWGYRFTPVLTLEDGFYE
VDYNSFHETYETSTPSLSAKELAELANRAEL
>3vsq_A mol:protein length:208  G protein-activated inward rectifier potassium channel 2
GSHMRKIQRYVRKDGKCNVHHGNVREKRAETLVFSTHAVISMRDGKLCLMFRVGDLRNS
HIVRASIRAKLIKSKQTSEGEFIPLNQTDINVGYYTGDDRLFLVSPLIISHEINQQSPF
WEISKAQLPKEELEIVVILEGMVEATGMTCQARSSYITSEILWGYRFTPVLTLEDGFYE
VDYNSFHETYETSTPSLSAKELAELANRAEL