>3vtu_A mol:protein length:123  Microtubule-associated proteins 1A/1B light chain 3B
GSPEFPSEKTFKQRRTFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVP
DHVNMSELIKIIRRRLQLNANQAFFLLVNGHSMVSVSTPISEVYESEKDEDGFLYMVYA
SQETF
>3vtu_A mol:protein length:123  Microtubule-associated proteins 1A/1B light chain 3B
GSPEFPSEKTFKQRRTFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVP
DHVNMSELIKIIRRRLQLNANQAFFLLVNGHSMVSVSTPISEVYESEKDEDGFLYMVYA
SQETF