>3wap_A mol:protein length:134  Autophagy-related protein 13, Microtubule-associated proteins 1A/1B light chain 3C
GSSSGNTHDDFVMIGSPSVRPFKQRKSLAIRQEEVAGIRAKFPNKIPVVVERYPRETFL
PPLDKTKFLVPQELTMTQFLSIIRSRMVLRATEAFYLLVNNKSLVSMSATMAEIYRDYK
DEDGFVYMTYASQETF
>3wap_A mol:protein length:134  Autophagy-related protein 13, Microtubule-associated proteins 1A/1B light chain 3C
GSSSGNTHDDFVMIGSPSVRPFKQRKSLAIRQEEVAGIRAKFPNKIPVVVERYPRETFL
PPLDKTKFLVPQELTMTQFLSIIRSRMVLRATEAFYLLVNNKSLVSMSATMAEIYRDYK
DEDGFVYMTYASQETF