>3zo7_F mol:protein length:94  5-CHLOROMUCONOLACTONE DEHALOGENASE
MLYLVRMTVNLPRNLDPREEERLKASAKARSRTLQEQGQWRYLWRTTGKYGNISVFDVN
SHDELHEILWSLPFFPYLTIDVEPLSHHPARVGKD
>3zo7_C mol:protein length:94  5-CHLOROMUCONOLACTONE DEHALOGENASE
MLYLVRMTVNLPRNLDPREEERLKASAKARSRTLQEQGQWRYLWRTTGKYGNISVFDVN
SHDELHEILWSLPFFPYLTIDVEPLSHHPARVGKD
>3zo7_B mol:protein length:94  5-CHLOROMUCONOLACTONE DEHALOGENASE
MLYLVRMTVNLPRNLDPREEERLKASAKARSRTLQEQGQWRYLWRTTGKYGNISVFDVN
SHDELHEILWSLPFFPYLTIDVEPLSHHPARVGKD
>3zo7_G mol:protein length:94  5-CHLOROMUCONOLACTONE DEHALOGENASE
MLYLVRMTVNLPRNLDPREEERLKASAKARSRTLQEQGQWRYLWRTTGKYGNISVFDVN
SHDELHEILWSLPFFPYLTIDVEPLSHHPARVGKD
>3zo7_A mol:protein length:94  5-CHLOROMUCONOLACTONE DEHALOGENASE
MLYLVRMTVNLPRNLDPREEERLKASAKARSRTLQEQGQWRYLWRTTGKYGNISVFDVN
SHDELHEILWSLPFFPYLTIDVEPLSHHPARVGKD
>3zo7_I mol:protein length:94  5-CHLOROMUCONOLACTONE DEHALOGENASE
MLYLVRMTVNLPRNLDPREEERLKASAKARSRTLQEQGQWRYLWRTTGKYGNISVFDVN
SHDELHEILWSLPFFPYLTIDVEPLSHHPARVGKD
>3zo7_D mol:protein length:94  5-CHLOROMUCONOLACTONE DEHALOGENASE
MLYLVRMTVNLPRNLDPREEERLKASAKARSRTLQEQGQWRYLWRTTGKYGNISVFDVN
SHDELHEILWSLPFFPYLTIDVEPLSHHPARVGKD
>3zo7_J mol:protein length:94  5-CHLOROMUCONOLACTONE DEHALOGENASE
MLYLVRMTVNLPRNLDPREEERLKASAKARSRTLQEQGQWRYLWRTTGKYGNISVFDVN
SHDELHEILWSLPFFPYLTIDVEPLSHHPARVGKD
>3zo7_J mol:protein length:94  5-CHLOROMUCONOLACTONE DEHALOGENASE
MLYLVRMTVNLPRNLDPREEERLKASAKARSRTLQEQGQWRYLWRTTGKYGNISVFDVN
SHDELHEILWSLPFFPYLTIDVEPLSHHPARVGKD
>3zo7_E mol:protein length:94  5-CHLOROMUCONOLACTONE DEHALOGENASE
MLYLVRMTVNLPRNLDPREEERLKASAKARSRTLQEQGQWRYLWRTTGKYGNISVFDVN
SHDELHEILWSLPFFPYLTIDVEPLSHHPARVGKD
>3zo7_H mol:protein length:94  5-CHLOROMUCONOLACTONE DEHALOGENASE
MLYLVRMTVNLPRNLDPREEERLKASAKARSRTLQEQGQWRYLWRTTGKYGNISVFDVN
SHDELHEILWSLPFFPYLTIDVEPLSHHPARVGKD