>3zo7_C mol:protein length:94  5-CHLOROMUCONOLACTONE DEHALOGENASE
MLYLVRMTVNLPRNLDPREEERLKASAKARSRTLQEQGQWRYLWRTTGKYGNISVFDVN
SHDELHEILWSLPFFPYLTIDVEPLSHHPARVGKD