>3zpl_G mol:na length:22  5'-D(*AP*AP*AP*GP*AP*TP*TP*GP*AP*GP*AP*TP*CP*TP *CP*AP*AP*TP*CP*TP*TP*DT)-3'
AAAGATTGAGATCTCAATCTTT
>3zpl_A mol:protein length:177  PUTATIVE MARR-FAMILY TRANSCRIPTIONAL REPRESSOR
MHHHHHHENLYFQGMNDEPRWLTAEEQLVWRSYIEAATLLEDHLDRQLQRDAGMPHVYY
GLLVKLAESPRRRLRMTELAKYAKITRSRLSHAVARLEKNGWVRREDCPSDKRGQFAIL
TDEGYEVLRRTAPGHVDAVRQAVFDRLTPEQQKSLGEIMRIVAEGLQPSEAGADLPWLR
>3zpl_C mol:na length:22  5'-D(*AP*AP*AP*GP*AP*TP*TP*GP*AP*GP*AP*TP*CP*TP *CP*AP*AP*TP*CP*TP*TP*DT)-3'
AAAGATTGAGATCTCAATCTTT
>3zpl_H mol:na length:22  5'-D(*AP*AP*AP*GP*AP*TP*TP*GP*AP*GP*AP*TP*CP*TP *CP*AP*AP*TP*CP*TP*TP*DT)-3'
AAAGATTGAGATCTCAATCTTT
>3zpl_B mol:protein length:177  PUTATIVE MARR-FAMILY TRANSCRIPTIONAL REPRESSOR
MHHHHHHENLYFQGMNDEPRWLTAEEQLVWRSYIEAATLLEDHLDRQLQRDAGMPHVYY
GLLVKLAESPRRRLRMTELAKYAKITRSRLSHAVARLEKNGWVRREDCPSDKRGQFAIL
TDEGYEVLRRTAPGHVDAVRQAVFDRLTPEQQKSLGEIMRIVAEGLQPSEAGADLPWLR
>3zpl_F mol:protein length:177  PUTATIVE MARR-FAMILY TRANSCRIPTIONAL REPRESSOR
MHHHHHHENLYFQGMNDEPRWLTAEEQLVWRSYIEAATLLEDHLDRQLQRDAGMPHVYY
GLLVKLAESPRRRLRMTELAKYAKITRSRLSHAVARLEKNGWVRREDCPSDKRGQFAIL
TDEGYEVLRRTAPGHVDAVRQAVFDRLTPEQQKSLGEIMRIVAEGLQPSEAGADLPWLR
>3zpl_D mol:na length:22  5'-D(*AP*AP*AP*GP*AP*TP*TP*GP*AP*GP*AP*TP*CP*TP *CP*AP*AP*TP*CP*TP*TP*DT)-3'
AAAGATTGAGATCTCAATCTTT
>3zpl_E mol:protein length:177  PUTATIVE MARR-FAMILY TRANSCRIPTIONAL REPRESSOR
MHHHHHHENLYFQGMNDEPRWLTAEEQLVWRSYIEAATLLEDHLDRQLQRDAGMPHVYY
GLLVKLAESPRRRLRMTELAKYAKITRSRLSHAVARLEKNGWVRREDCPSDKRGQFAIL
TDEGYEVLRRTAPGHVDAVRQAVFDRLTPEQQKSLGEIMRIVAEGLQPSEAGADLPWLR
>3zpl_H mol:na length:22  5'-D(*AP*AP*AP*GP*AP*TP*TP*GP*AP*GP*AP*TP*CP*TP *CP*AP*AP*TP*CP*TP*TP*DT)-3'
AAAGATTGAGATCTCAATCTTT