>43c9_A mol:protein length:113  PROTEIN (IMMUNOGLOBULIN (LIGHT CHAIN))
DVVMTQTPSSLAMSVGQKVTMSCKSSQSLLNISNQKNYLAWYQQKPGQSPKLLVYFAST
RESGVPDRFIGSGSGTDFTLTISSVQAEDQADYFCQQHYRAPRTFGGGTKLEIK