>43c9_B mol:protein length:118  PROTEIN (IMMUNOGLOBULIN (HEAVY CHAIN))
GQVQLVESGPGLVAPSQSLSITCTVSGISLSRYNVHWVRQSPGKGLEWLGMIWGGGSIE
YNPALKSRLSISKDNSKSQIFLKMNSLQTDDSAMYYCVSYGYGGDRFSYWGQGTLVTVS