>43c9_E mol:protein length:113  PROTEIN (IMMUNOGLOBULIN (LIGHT CHAIN))
DVVMTQTPSSLAMSVGQKVTMSCKSSQSLLNISNQKNYLAWYQQKPGQSPKLLVYFAST
RESGVPDRFIGSGSGTDFTLTISSVQAEDQADYFCQQHYRAPRTFGGGTKLEIK