>4a3e_D mol:protein length:221  DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB4
MNVSTSTFQTRRRRLKKVEEEENAATLQLGQEFQLKQINHQGEEEELIALNLSEARLVI
KEALVERRRAFKRSQKKHKKKHLKHENANDETTAVEDEDDDLDEDDVNADDDDFMHSET
REKELESIDVLLEQTTGGNNKDLKNTMQYLTNFSRFRDQETVGAVIQLLKSTGLHPFEV
AQLGSLACDTADEAKTLIPSLNNKISDDELERILKELSNLETLY