>4a3e_F mol:protein length:155  DNA-DIRECTED RNA POLYMERASES I, II, AND III SUBUNIT RPABC 2
MSDYEEAFNDGNENFEDFDVEHFSDEETYEEKPQFKDGETTDANGKTIVTGGNGPEDFQ
QHEQIRRKTLKEKAIPKDQRATTPYMTKYERARILGTRALQISMNAPVFVDLEGETDPL
RIAMKELAEKKIPLVIRRYLPDGSFEDWSVEELIVDL