>4a3k_E mol:protein length:215  DNA-DIRECTED RNA POLYMERASES I, II, AND III SUBUNIT RPABC 1
MDQENERNISRLWRAFRTVKEMVKDRGYFITQEEVELPLEDFKAKYCDSMGRPQRKMMS
FQANPTEESISKFPDMGSLWVEFCDEPSVGVKTMKTFVIHIQEKNFQTGIFVYQNNITP
SAMKLVPSIPPATIETFNEAALVVNITHHELVPKHIRLSSDEKRELLKRYRLKESQLPR
IQRADPVALYLGLKRGEVVKIIRKSETSGRYASYRICM