>4a3k_I mol:protein length:122  DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB9
MTTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVV
QDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKR
TQFS