>4a9h_A mol:protein length:154  BROMODOMAIN-CONTAINING PROTEIN 2
GSSHHHHHHSSGLVPRGSHMSNPKKPGRVTNQLQYLHKVVMKALWKHQFAWPFRQPVDA
VKLGLPDYHKIIKQPMDMGTIKRRLENNYYWAASECMQDFNTMFTNCYIYNKPTDDIVL
MAQTLEKIFLQKVASMPQEEQELVVTIPKNSHKKGA