>4a9h_C mol:protein length:154  BROMODOMAIN-CONTAINING PROTEIN 2
GSSHHHHHHSSGLVPRGSHMSNPKKPGRVTNQLQYLHKVVMKALWKHQFAWPFRQPVDA
VKLGLPDYHKIIKQPMDMGTIKRRLENNYYWAASECMQDFNTMFTNCYIYNKPTDDIVL
MAQTLEKIFLQKVASMPQEEQELVVTIPKNSHKKGA