>4a9j_B mol:protein length:154  BROMODOMAIN CONTAINING 2
GSSHHHHHHSSGLVPRGSHMSNPKKPGRVTNQLQYLHKVVMKALWKHQFAWPFRQPVDA
VKLGLPDYHKIIKQPMDMGTIKRRLENNYYWAASECMQDFNTMFTNCYIYNKPTDDIVL
MAQTLEKIFLQKVASMPQEEQELVVTIPKNSHKKGA