>4a9n_C mol:protein length:154  BROMODOMAIN CONTAINING 2
GSSHHHHHHSSGLVPRGSHMSNPKKPGRVTNQLQYLHKVVMKALWKHQFAWPFRQPVDA
VKLGLPDYHKIIKQPMDMGTIKRRLENNYYWAASECMQDFNTMFTNCYIYNKPTDDIVL
MAQTLEKIFLQKVASMPQEEQELVVTIPKNSHKKGA
>4a9n_A mol:protein length:154  BROMODOMAIN CONTAINING 2
GSSHHHHHHSSGLVPRGSHMSNPKKPGRVTNQLQYLHKVVMKALWKHQFAWPFRQPVDA
VKLGLPDYHKIIKQPMDMGTIKRRLENNYYWAASECMQDFNTMFTNCYIYNKPTDDIVL
MAQTLEKIFLQKVASMPQEEQELVVTIPKNSHKKGA
>4a9n_C mol:protein length:154  BROMODOMAIN CONTAINING 2
GSSHHHHHHSSGLVPRGSHMSNPKKPGRVTNQLQYLHKVVMKALWKHQFAWPFRQPVDA
VKLGLPDYHKIIKQPMDMGTIKRRLENNYYWAASECMQDFNTMFTNCYIYNKPTDDIVL
MAQTLEKIFLQKVASMPQEEQELVVTIPKNSHKKGA
>4a9n_B mol:protein length:154  BROMODOMAIN CONTAINING 2
GSSHHHHHHSSGLVPRGSHMSNPKKPGRVTNQLQYLHKVVMKALWKHQFAWPFRQPVDA
VKLGLPDYHKIIKQPMDMGTIKRRLENNYYWAASECMQDFNTMFTNCYIYNKPTDDIVL
MAQTLEKIFLQKVASMPQEEQELVVTIPKNSHKKGA