>4aor_A mol:protein length:223  CATIONIC TRYPSIN
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVE
GNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLI
SGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDS
GGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
>4aor_D mol:protein length:37  TRYPSIN INHIBITOR 3
EDKCSPSGAICSGFGPPEQCCSGACVPHPILRIFVCQ
>4aor_E mol:protein length:37  TRYPSIN INHIBITOR 3
EDKCSPSGAICSGFGPPEQCCSGACVPHPILRIFVCQ
>4aor_B mol:protein length:223  CATIONIC TRYPSIN
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVE
GNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLI
SGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDS
GGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
>4aor_C mol:protein length:223  CATIONIC TRYPSIN
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVE
GNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLI
SGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDS
GGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
>4aor_F mol:protein length:37  TRYPSIN INHIBITOR 3
EDKCSPSGAICSGFGPPEQCCSGACVPHPILRIFVCQ
>4aor_F mol:protein length:37  TRYPSIN INHIBITOR 3
EDKCSPSGAICSGFGPPEQCCSGACVPHPILRIFVCQ