>4aor_E mol:protein length:37  TRYPSIN INHIBITOR 3
EDKCSPSGAICSGFGPPEQCCSGACVPHPILRIFVCQ