>4ar3_A mol:protein length:54  RUBREDOXIN
MAKWVCKICGYIYDEDAGDPDNGISPGTKFEELPDDWVCPICGAPKSEFEKLED
>4ar3_A mol:protein length:54  RUBREDOXIN
MAKWVCKICGYIYDEDAGDPDNGISPGTKFEELPDDWVCPICGAPKSEFEKLED