>4ar5_A mol:protein length:54  RUBREDOXIN
MAKWVCKICGYIYDEDAGDPDNGISPGTKFEELPDDWVCPICGAPKSEFEKLED