>4by7_J mol:protein length:70  DNA-DIRECTED RNA POLYMERASES I, II, AND III SUBUNIT RPABC 5
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEK
FLRYNPLEKRD