>4by7_K mol:protein length:120  DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB11
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFA
AYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTLAADD
AF