>4c3p_B mol:protein length:43  TARGETING PROTEIN FOR XKLP2
MSQVKSSYSYDAPSDFINFSSLDDEGDTQNIDSWFEEKANLEN