>4cdc_F mol:protein length:69  DIPEPTIDYL PEPTIDASE 1 LIGHT CHAIN
DPFNPFELTNHAVLLVGYGTDSASGMDYWIVKNSWGTGWGENGYFRIRRGTDECAIESI
AVAATPIPKL