>4cdc_G mol:protein length:119  DIPEPTIDYL PEPTIDASE 1 EXCLUSION DOMAIN CHAIN
DTPANCTYLDLLGTWVFQVGSSGSQRDVNCSVMGPQEKKVVVYLQKLDTAYDDLGNSGH
FTIIYNQGFEIVLNDYKWFAFFKYKEEGSKVTTYCNETMTGWVHDVLGRNWACFTGKKV
G