>4cgs_B mol:protein length:173  POLYMERASE SUBUNIT PA
GAMDRHKPKSISSEIWALSETSKEWMSNLRPLEARIVECIKYTVCCHISDMHLHNGVPR
YIVNMWTPPEVADQEMKRQNLIFARPNVPDLLDLKERKGVYVKVYPDNGTPTDYQTAEN
EIFVRVSLSGQMSPITREYLDEVQRQDVTNFLVTIYNESLESNLLERMQELYDTD