>4d1q_B mol:protein length:536  TRANSPOSASE
HMQSRELKTVSADCKKEAIEKCAQWVVRDCRPFSAVSGSGFIDMIKFFIKVGAEYGEHV
NVEELLPSPITLSRKVTSDAKEKKALIGREIKSAVEKDGASATIDLWTDNYIKRNFLGV
TLHYHENNELRDLILGLKSLDFERSTAENIYKKLKAIFSQFNVEDLSSIKFVTDRGANV
VKSLANNIRINCSSHLLSNVLENSFEETPELNMPILACKNIVKYFKKANLQHRLRSSLK
SECPTRWNSTYTMLRSILDNWESVIQILSEAGETQRIVHINKSIIQTMVNILDGFERIF
KELQTCSSPSLCFVVPSILKVKEICSPDVGDVADIAKLKVNIIKNVRIIWEENLSIWHY
TAFFFYPPALHMQQEKVAQIKEFCLSKMEDLELINRMSSFNELSATQLNQSDSNSHNSI
DLTSHSKDISTTSFFFPQLTQNNSREPPVCPSDEFEFYRKEIVILSEDFKVMEWWNLNS
KKYPKLSKLALSLLSIPASSAASERTFSLAGNIITEKRNRIGQQTVDSLLFLNSFYKNF
CKLDI