>4day_B mol:protein length:150  RecQ-mediated genome instability protein 2
GSHMAAAADSFSGGPAGVRLPRSPPLKVLAEQLRRDAEGGPGAWRLSRAAAGRGPLDLA
AVWMQGRVVMADRGEARLRDPSGDFSVRGLERVPRGRPCLVPGKYVMVMGVVQACSPEP
CLQAVKMTDLSDNPIHESMWELEVEDLHRNIP