>4dk9_A mol:protein length:157  Methyl-CpG-binding domain protein 4
GSALSPPRRKAFKKWTPPRSPFNLVQETLFHDPWKLLIATIFLNRTSGKMAIPVLWKFL
EKYPSAEVARTADWRDVSELLKPLGLYDLRAKTIVKFSDEYLTKQWKYPIELHGIGKYG
NDSYRIFCVNEWKQVHPEDHKLNKYHDWLWENHEKLSLS
>4dk9_B mol:na length:11  5'-D(*AP*AP*GP*AP*CP*GP*TP*GP*GP*AP*C)-3'
AAGACGTGGAC
>4dk9_C mol:na length:11  5'-D(*TP*GP*TP*CP*CP*AP*(3DR)P*GP*TP*CP*T)-3'
TGTCCANGTCT
>4dk9_C mol:na length:11  5'-D(*TP*GP*TP*CP*CP*AP*(3DR)P*GP*TP*CP*T)-3'
TGTCCANGTCT