>4dub_A mol:protein length:472  cytochrome P450 BM3 variant 9D7
MTIKEMPQPKTFGELKNLPLLNTDKPVQALMKIADELGEIFKFEAPGRVTRYLSSQRLI
KEACDESRFDKNLSQALKFVRDFAGDGLFTSWTHEKNWKKAHNILLPSFSQQAMKGYHA
MMVDIAVQLVQKWERLNADEHIEVPEDMTRLTLDTIGLCGFNYRFNSFYRDQPHPFITS
MVRALDEAMNKLQRANPDDPAYDENKRQFQEDIKVMNDLVDKIIADRKASGEQSDDLLT
HMLNGKDPETGEPLDDENIRYQIITFLAAGHEATSGLLSFALYFLVKNPHVLQKAAEEA
ARVLVDPVPSYKQVKQLKYVGMVLNEALRLWPTGPAFSLYAKEDTVLGGEYPLEKGDEL
MVLIPQLHRDKTIWGDDVEEFRPERFENPSAIPQHAFKPFGNGQRACIGQQFALHEATL
VLGMMLKHFDFEDHTNYELDIKETLVLKPEGFVVKAKSKKIPLGGIPSPSTLEHHHHHH
>4dub_B mol:protein length:472  cytochrome P450 BM3 variant 9D7
MTIKEMPQPKTFGELKNLPLLNTDKPVQALMKIADELGEIFKFEAPGRVTRYLSSQRLI
KEACDESRFDKNLSQALKFVRDFAGDGLFTSWTHEKNWKKAHNILLPSFSQQAMKGYHA
MMVDIAVQLVQKWERLNADEHIEVPEDMTRLTLDTIGLCGFNYRFNSFYRDQPHPFITS
MVRALDEAMNKLQRANPDDPAYDENKRQFQEDIKVMNDLVDKIIADRKASGEQSDDLLT
HMLNGKDPETGEPLDDENIRYQIITFLAAGHEATSGLLSFALYFLVKNPHVLQKAAEEA
ARVLVDPVPSYKQVKQLKYVGMVLNEALRLWPTGPAFSLYAKEDTVLGGEYPLEKGDEL
MVLIPQLHRDKTIWGDDVEEFRPERFENPSAIPQHAFKPFGNGQRACIGQQFALHEATL
VLGMMLKHFDFEDHTNYELDIKETLVLKPEGFVVKAKSKKIPLGGIPSPSTLEHHHHHH
>4dub_B mol:protein length:472  cytochrome P450 BM3 variant 9D7
MTIKEMPQPKTFGELKNLPLLNTDKPVQALMKIADELGEIFKFEAPGRVTRYLSSQRLI
KEACDESRFDKNLSQALKFVRDFAGDGLFTSWTHEKNWKKAHNILLPSFSQQAMKGYHA
MMVDIAVQLVQKWERLNADEHIEVPEDMTRLTLDTIGLCGFNYRFNSFYRDQPHPFITS
MVRALDEAMNKLQRANPDDPAYDENKRQFQEDIKVMNDLVDKIIADRKASGEQSDDLLT
HMLNGKDPETGEPLDDENIRYQIITFLAAGHEATSGLLSFALYFLVKNPHVLQKAAEEA
ARVLVDPVPSYKQVKQLKYVGMVLNEALRLWPTGPAFSLYAKEDTVLGGEYPLEKGDEL
MVLIPQLHRDKTIWGDDVEEFRPERFENPSAIPQHAFKPFGNGQRACIGQQFALHEATL
VLGMMLKHFDFEDHTNYELDIKETLVLKPEGFVVKAKSKKIPLGGIPSPSTLEHHHHHH