>4duq_A mol:protein length:98  Protein S100-A2
MMSSSLEQALAVLVTTFHKYSSQEGDKFKLSKGEMKELLHKELPSFVGEKVDEEGLKKL
MGSLDENSDQQVDFQEYAVFLALITVMSNDFFQGCPDRP