>4ed7_A mol:protein length:435  DNA polymerase eta
GPHMATGQDRVVALVDMDCFFVQVEQRQNPHLRNKPCAVVQYKSWKGGGIIAVSYEARA
FGVTRSMWADDAKKLCPDLLLAQVRESRGKANLTKYREASVEVMEIMSRFAVIERASID
EAYVDLTSAVQERLQKLQGQPISADLLPSTYIEGLPQGPTTAEETVQKEGMRKQGLFQW
LDSLQIDNLTSPDLQLTVGAVIVEEMRAAIERETGFQCSAGISHNKVLAKLACGLNKPN
RQTLVSHGSVPQLFSQMPIRKIRSLGGKLGASVIEILGIEYMGELTQFTESQLQSHFGE
KNGSWLYAMCRGIEHDPVKPRQLPKTIGCSKNFPGKTALATREQVQWWLLQLAQELEER
LTKDRNDNDRVATQLVVSIRVQGDKRLSSLRRCCALTRYDAHKMSHDAFTVIKNCNTSG
IQTEWSPPLTMLFLCATKFSAS
>4ed7_P mol:na length:8  DNA (5'-D(*TP*GP*CP*GP*TP*CP*AP*T)-3')
TGCGTCAT
>4ed7_T mol:na length:12  DNA (5'-D(*CP*AP*TP*TP*AP*TP*GP*AP*CP*GP*CP*G)-3')
CATTATGACGCG
>4ed7_P mol:na length:8  DNA (5'-D(*TP*GP*CP*GP*TP*CP*AP*T)-3')
TGCGTCAT