>4enm_B mol:na length:13  DNA (5'-D(*GP*CP*CP*AP*TP*GP*(BZG)P*CP*TP*AP*GP*TP*A)-3')
GCCATGNCTAGTA
>4enm_C mol:na length:13  DNA (5'-D(*CP*TP*AP*CP*TP*AP*GP*CP*CP*AP*TP*GP*G)-3')
CTACTAGCCATGG
>4enm_C mol:na length:13  DNA (5'-D(*CP*TP*AP*CP*TP*AP*GP*CP*CP*AP*TP*GP*G)-3')
CTACTAGCCATGG
>4enm_A mol:protein length:116  Alkyltransferase-like protein 1
MRMDEFYTKVYDAVCEIPYGKVSTYGEIARYVGMPSYARQVGQAMKHLHPETHVPWHRV
INSRGTISKRDISAGEQRQKDRLEEEGVEIYQTSLGEYKLNLPEYMWKPGSHHHHHH