>4enm_A mol:protein length:116  Alkyltransferase-like protein 1
MRMDEFYTKVYDAVCEIPYGKVSTYGEIARYVGMPSYARQVGQAMKHLHPETHVPWHRV
INSRGTISKRDISAGEQRQKDRLEEEGVEIYQTSLGEYKLNLPEYMWKPGSHHHHHH