>4fpr_A mol:protein length:131  Avirulence Effector AvrLm4-7
AYVCREASISGEIRYPQGTCPTKTEALNDCNKVTKGLIDFSQSHQRAWGIDMTAKVQCA
PCKTTDPWDVVLCTCKITAHRYREFVPKIPYSSFSSAPGVIFRQETGLDHDPEWVVNMK
ARTRGCDHHHHHH