>4fzy_D mol:na length:12  DNA (5'-D(P*CP*TP*CP*GP*AP*AP*TP*CP*TP*AP*CP*A)-3')
CTCGAATCTACA
>4fzy_C mol:na length:12  DNA (5'-D(*TP*GP*TP*AP*GP*AP*TP*TP*CP*GP*AP*G)-3')
TGTAGATTCGAG
>4fzy_D mol:na length:12  DNA (5'-D(P*CP*TP*CP*GP*AP*AP*TP*CP*TP*AP*CP*A)-3')
CTCGAATCTACA
>4fzy_A mol:protein length:175  Exodeoxyribonuclease 10
MLRIIDTETCGLQGGIVEIASVDVIDGKIVNPMSHLVRPDRPISPQAMAIHRITEAMVA
DKPWIEDVIPHYYGSEWYVAHNASFDRRVLPEMPGEWICTMKLARRLWPGIKYSNMALY
KTRKLNVQTPPGLHHHRALYDCYITAALLIDIMNTSGWTAEQMADITGRLEHHHHHH
>4fzy_B mol:protein length:175  Exodeoxyribonuclease 10
MLRIIDTETCGLQGGIVEIASVDVIDGKIVNPMSHLVRPDRPISPQAMAIHRITEAMVA
DKPWIEDVIPHYYGSEWYVAHNASFDRRVLPEMPGEWICTMKLARRLWPGIKYSNMALY
KTRKLNVQTPPGLHHHRALYDCYITAALLIDIMNTSGWTAEQMADITGRLEHHHHHH