>4fzy_A mol:protein length:175  Exodeoxyribonuclease 10
MLRIIDTETCGLQGGIVEIASVDVIDGKIVNPMSHLVRPDRPISPQAMAIHRITEAMVA
DKPWIEDVIPHYYGSEWYVAHNASFDRRVLPEMPGEWICTMKLARRLWPGIKYSNMALY
KTRKLNVQTPPGLHHHRALYDCYITAALLIDIMNTSGWTAEQMADITGRLEHHHHHH