>4ggf_V mol:protein length:114  Protein S100-A9
MTSKMSQLERNIETIINTFHQYSVKLGHPDTLNQGEFKELVRKDLQNFLKKENKNEKVI
EHIMEDLDTNADKQLSFEEFIMLMARLTWASHEKMHEGDEGPGHHHKPGLGEGTP
>4ggf_C mol:protein length:114  Protein S100-A9
MTSKMSQLERNIETIINTFHQYSVKLGHPDTLNQGEFKELVRKDLQNFLKKENKNEKVI
EHIMEDLDTNADKQLSFEEFIMLMARLTWASHEKMHEGDEGPGHHHKPGLGEGTP
>4ggf_L mol:protein length:114  Protein S100-A9
MTSKMSQLERNIETIINTFHQYSVKLGHPDTLNQGEFKELVRKDLQNFLKKENKNEKVI
EHIMEDLDTNADKQLSFEEFIMLMARLTWASHEKMHEGDEGPGHHHKPGLGEGTP
>4ggf_A mol:protein length:93  Protein S100-A8
MLTELEKALNSIIDVYHKYSLIKGNFHAVYRDDLKKLLETESPQYIRKKGADVWFKELD
INTDGAVNFQEFLILVIKMGVAAHKKSHEESHKE
>4ggf_S mol:protein length:93  Protein S100-A8
MLTELEKALNSIIDVYHKYSLIKGNFHAVYRDDLKKLLETESPQYIRKKGADVWFKELD
INTDGAVNFQEFLILVIKMGVAAHKKSHEESHKE
>4ggf_T mol:protein length:114  Protein S100-A9
MTSKMSQLERNIETIINTFHQYSVKLGHPDTLNQGEFKELVRKDLQNFLKKENKNEKVI
EHIMEDLDTNADKQLSFEEFIMLMARLTWASHEKMHEGDEGPGHHHKPGLGEGTP
>4ggf_U mol:protein length:93  Protein S100-A8
MLTELEKALNSIIDVYHKYSLIKGNFHAVYRDDLKKLLETESPQYIRKKGADVWFKELD
INTDGAVNFQEFLILVIKMGVAAHKKSHEESHKE
>4ggf_V mol:protein length:114  Protein S100-A9
MTSKMSQLERNIETIINTFHQYSVKLGHPDTLNQGEFKELVRKDLQNFLKKENKNEKVI
EHIMEDLDTNADKQLSFEEFIMLMARLTWASHEKMHEGDEGPGHHHKPGLGEGTP
>4ggf_K mol:protein length:93  Protein S100-A8
MLTELEKALNSIIDVYHKYSLIKGNFHAVYRDDLKKLLETESPQYIRKKGADVWFKELD
INTDGAVNFQEFLILVIKMGVAAHKKSHEESHKE