>4ggf_S mol:protein length:93  Protein S100-A8
MLTELEKALNSIIDVYHKYSLIKGNFHAVYRDDLKKLLETESPQYIRKKGADVWFKELD
INTDGAVNFQEFLILVIKMGVAAHKKSHEESHKE