>4gtu_H mol:protein length:217  GLUTATHIONE S-TRANSFERASE
SMTLGYWDIRGLAHAIRLLLEYTDSSYEEKKYTMGDAPDYDRSQWLNEKFKLGLDFPNL
PYLIDGAHKITQSNAILCYIARKHNLCGETEEEKIRVDILENQAMDVSNQLARVCYSPD
FEKLKPEYLEELPTMMQHFSQFLGKRPWFVGDKITFVDFLAYDVLDLHRIFEPNCLDAF
PNLKDFISRFEGLEKISAYMKSSRFLPKPLYTRVAVWGNK