>4gyx_A mol:protein length:31 Type III collagen fragment in a host peptide stabilized by the cysteine knot GPPGPPGPRGQPGVMGFPGPPGPPGPCCGGV >4gyx_B mol:protein length:31 Type III collagen fragment in a host peptide stabilized by the cysteine knot GPPGPPGPRGQPGVMGFPGPPGPPGPCCGGV >4gyx_C mol:protein length:31 Type III collagen fragment in a host peptide stabilized by the cysteine knot GPPGPPGPRGQPGVMGFPGPPGPPGPCCGGV >4gyx_C mol:protein length:31 Type III collagen fragment in a host peptide stabilized by the cysteine knot GPPGPPGPRGQPGVMGFPGPPGPPGPCCGGV