>4hi7_B mol:protein length:228  GI20122
MVKPILYGIDASPPVRAVKLTLAALQLPYDYKIVNLMNKEQHSEEYLKKNPQHTVPLLE
DGDANIADSHAIMAYLVSKYGKDDSLYPKDLVKRALVDNRMYFESGVVFANALRSLAKM
ILFLGKTEVPQERIDAITEAYDFVEAFFKDQTYVAGNQLTIADFSLISSISSLVAFVPV
DAAKYPKLSAWIKRLEQLPYYAENSTGAQQFVAAVKSKPFTVVGAENLYFQ