>4hkc_B mol:protein length:30  alpha-4 integrin derived phosphorylated peptide
GFFKRQYKSILQEENRRDSWSYINSKSNDD