>4hs2_A mol:protein length:110  Speckle-type POZ protein
GPLGSADDDLAAADKYADERKKVMCEDALCSNLSVENAAEILILADLHSADQLKTQAVD
FINYHASDVLETSGWKSMVVSHPHLVAEAYRSLASAQCPFLGPPRKRLKQS