>4hxg_I mol:protein length:622  Putative uncharacterized protein PH0594
MTSIEWDEKTFTKFAYLSDPRTRKNLVAYVLTKANLESNKYENTIVIENLEDGSRKFIE
DASMPRISPDGKKIAFMRFNEEKKTAQIWVADLKTLSAKKVLEAKNIRSIEWNQDSRRL
LAVGFKRREDEDFIFEDDVPAWFDNMGFFDGEKTTFWVIDTEGEEVIEQFEKPRFSSGI
WHGDSIVVSVPHRDVIPRYFKYWDIYLWKDGEEEKLFEKVSFYAIDSDGERILLYGKPE
KKYVSEHDKIYIYDGEVKGILDDIDREVAQAKIRNGKVYFTLFEEGSVNLYLWDGEVRE
IAKGKHWIMGFDADERLIYLKETATRPAELYLWDGEERQLTDYNGLIFKKLKTFEPRHF
RFKSIDLELDGWYIKPEIKEGEKAPVIVFVHGGPKGMYGYYFKYEMQLMASKGYYIVYV
NPRGSNGYSEDFALRVLERTGLEDFQDILNGIEEFLRLEPQADRERIGITGIAYGGYMT
NWALTQSDLFKAGISENGISYWLTSYAFSDIGLWFDKEVIGDNPLENENYRKLSPLFYA
KNVKAPLLLIHSLEDYRCPLDQSLMFYHVLKDLGKEVYIAIFKKGAHGHSIRGSPRHRM
KRYKLFMEFFERKLKKYEEGFDVEKILKEEKK