>4i1q_A mol:protein length:221  Bridging integrator 2
GSKFSRAQEKVLQKLGKAVETKDERFEQSANNFYQQQAEGHKLYKDLKNFLSAVKVMHE
SSKRVSETLQEIYSSEWDGHEELKAIVWNNDLLWEDYEEKLADQAVRTMEIYVAQFSEI
KERIAKRGRKLVDYDSARHHLEAVQNAKKKDEAKTAKAEEEFNKAQTVFEDLNQELLEE
LPILYNSRIGCYVTIFQNISNLRDVFYREMSKLNHNLYEVMSKL