>4i1q_B mol:protein length:221  Bridging integrator 2
GSKFSRAQEKVLQKLGKAVETKDERFEQSANNFYQQQAEGHKLYKDLKNFLSAVKVMHE
SSKRVSETLQEIYSSEWDGHEELKAIVWNNDLLWEDYEEKLADQAVRTMEIYVAQFSEI
KERIAKRGRKLVDYDSARHHLEAVQNAKKKDEAKTAKAEEEFNKAQTVFEDLNQELLEE
LPILYNSRIGCYVTIFQNISNLRDVFYREMSKLNHNLYEVMSKL