>4i2c_C mol:na length:5  5'-D(*AP*AP*AP*AP*A)-3'
AAAAA
>4i2c_A mol:protein length:400  DNA nucleotidylexotransferase
MGSSHHHHHHSSGLVPRGSHMSPSPVPGSQNVPAPAVKKISQYACQRRTTLNNYNQLFT
DALDILAENDELRENEGSCLAFMRASSVLKSLPFPITSMKDTEGIPCLGDKVKSIIEGI
IEDGESSEAKAVLNDERYKSFKLFTSVFGVGLKTAEKWFRMGFRTLSKIQSDKSLRFTQ
MQKAGFLYYEDLVSCVNRPEAEAVSMLVKEAVVTFLPDALVTMTGGFRRGKMTGHDVDF
LITSPEATEDEEQQLLHKVTDFWKQQGLLLYCDILESTFEKFKQPSRKVDALDHFQKCF
LILKLDHGRVHSEKSGQQEGKGWKAIRVDLVMCPYDRRAFALLGWTGSRQFERDLRRYA
THERKMMLDNHALYDRTKRVFLEAESEEEIFAHLGLDYIEPWERNA
>4i2c_C mol:na length:5  5'-D(*AP*AP*AP*AP*A)-3'
AAAAA