>4i6u_E mol:protein length:82  Regulatory protein
GSHMESFLLSKVSFVIKKIRLEKGMTQEDLAYKSNLDRTFISGIERNSRNLTIKSLELI
MKGLEVSDVVFFEMLIKEILKHD